Cover More Sequence Space, Screen Less: Diversity Selection with Embeddings

Cluster your library in sequence space with ESM2 embeddings and select diverse representatives before you screen.




What you'll learn:

  • Generating ESM2-8m embeddings via the pipeline SDK
  • K-means clustering with silhouette score selection
  • PCA visualization of sequence space
  • Diversity sampling across clusters

export BIOLMAI_TOKEN=your-token-here

Setup

import os
from biolmai.pipeline import (
    DataPipeline, DuckDBDataStore,
    ThresholdFilter, RankingFilter,
    ValidAminoAcidFilter, EmbeddingSpec,
    DiversitySamplingFilter,
)

TOKEN = os.environ.get("BIOLMAI_TOKEN", "")
if not TOKEN:
    raise EnvironmentError(
        "Set BIOLMAI_TOKEN before running.\n"
        "Get one at https://biolm.ai/ui/accounts/user-api-tokens/"
    )
import numpy as np
import matplotlib.pyplot as plt
from sklearn.decomposition import PCA
from sklearn.metrics import silhouette_score
from sklearn.cluster import KMeans

Peptide library

50 antimicrobial peptides from three families: magainins, defensins, and designed sequences.

MY_50_PEPTIDES = [
    "GIGKFLHSAKKFGKAFVGEIMNS", "GIGKFLHSAGKFGKAFVGEIMKS", "GLFDIIKKIAESF",
    "GLFDIVKKVVGALGSL", "FLPLILRKIVTAL", "GIKKFLGSIWKFIKAFVKEIMN",
    "GLFDIIKKIAESFLPKV", "GIGKFLHSAKKFGKAFV", "GIGKFLHSAK", "GIGKFLHSAKKFGK",
    "[LL-37, 37 aa]", "RLFDKIRQVIRKF",
    "KWKLFKKIPKFLHLAKKF", "KWKLFKKIPKFLHLAK", "FKRIVQRIKDFL",
    "RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQATQIAK",
    "KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK",
    "GIGAVLKVLTTGLPALISWIKRKRQQ", "VDKGSYLPRPTPPRPIYNRN", "GKPRPYSPRPTSHPRPIRV",
    "KLAKLAKKLAKLAK", "LKLLKKLLKLLKKL", "RRWWRRWWRR", "KWKWKWKWKW",
    "RRLCRIVVIRVCR", "RRWQWR", "RWRWRW", "KFLKKAKKFGK",
    "KWKLFKKI", "RLFDKIRQ",
    "ACYCRIPACIAGERRYGTCIYQGRLWAFCC", "GCSKNKGCSVDKECAAFGSR",
    "DCSCFGGKGETACNKCKTPEGKPCTEGKPCK", "GFCKLCCNPACGPNYKGICIDM",
    "AFGKQLAKLAKSKLAKLAKLAK", "KLALKLALKALKAALKLA",
    "WKWLKKWLKKLK", "RWKKWWRRKK", "KFKKLFKKLKK",
    "FLGALFKALSKLL", "ALLKFLLKFLLK", "GLLDFLK",
    "KKLFKKILKYL", "FFKDEL", "ILKKWPWWPWRR",
    "GLWSKIKEVGKEAAKAAAKAAGKAALNAVTGGGKPG",
    "KLKLLLLLKLK", "WKLFKKIKVWK", "KWKWFKKIKVWK", "KLFKKIKVWKK",
]
print(f"{len(MY_50_PEPTIDES)} peptides")
50 peptides

Embed with ESM2-8m

ds = DuckDBDataStore("cluster_demo.duckdb")

cp = DataPipeline(sequences=MY_50_PEPTIDES, datastore=ds, verbose=True)
cp.add_filter(ValidAminoAcidFilter(), stage_name="validate")
cp.add_prediction(
    "esm2-8m", action="encode",
    embedding_extractor=EmbeddingSpec(key="embeddings", layer=6),
    stage_name="embed", depends_on=["validate"],
)
cp.add_clustering(
    method="kmeans", n_clusters=3,
    similarity_metric="embedding", embedding_model="esm2-8m",
    stage_name="cluster_k3", depends_on=["embed"],
)
cp.run()
Added stage: FilterStage('validate')
Added stage: PredictionStage('embed', depends_on=['validate'])
Added stage: ClusteringStage('cluster_k3', depends_on=['embed'])

############################################################
# Pipeline: DataPipeline
# Run ID: 20260617_141553_ba38f1d1
# Initial sequences: 50
# Streaming: ENABLED
############################################################

Execution plan: 3 level(s)
  Level 1: validate
  Level 2: embed
  Level 3: cluster_k3

============================================================
Stage: validate
Input: 50 sequences
  Applying filter: ValidAminoAcidFilter(alphabet='ACDEFGHIKLMNPQRSTVWY')
  Filtered out: 0/50
  Remaining: 50

StageResult(validate: in=50, out=50, cached=0, computed=0, filtered=0, time=0.0s)
============================================================

============================================================
Stage: embed
Input: 50 sequences
Depends on: validate
  Cached: 0/50
  To compute: 50
  Calling esm2-8m.encode...
Completed: 50 sequences in 2 batches (max 5 concurrent)

StageResult(embed: in=50, out=50, cached=0, computed=50, filtered=0, time=2.2s)
============================================================

============================================================
Stage: cluster_k3
Input: 50 sequences
Depends on: embed
  Clustering 50 sequences using kmeans...
  Loading embeddings from esm2-8m...
  Found 3 clusters
  Silhouette score: 0.151

StageResult(cluster_k3: in=50, out=50, cached=0, computed=50, filtered=0, time=0.2s)
============================================================
############################################################
# Pipeline completed in 2.5s
# Final sequences: 50
############################################################
{'validate': StageResult(validate: in=50, out=50, cached=0, computed=0, filtered=0, time=0.0s),
 'embed': StageResult(embed: in=50, out=50, cached=0, computed=50, filtered=0, time=2.2s),
 'cluster_k3': StageResult(cluster_k3: in=50, out=50, cached=0, computed=50, filtered=0, time=0.2s)}

Choose k with silhouette scores

Because embeddings are cached, re-clustering at different k values costs nothing.

sequence_ids = [r[0] for r in ds.conn.execute("SELECT sequence_id FROM sequences").fetchall()]
emb_map = ds.get_embeddings_bulk(sequence_ids, model_name="esm2-8m")
mat = np.stack([emb_map[sid] for sid in sequence_ids])

scores = {}
for k in range(2, 9):
    labels = KMeans(n_clusters=k, random_state=42, n_init=10).fit_predict(mat)
    scores[k] = silhouette_score(mat, labels)
    print(f"k={k}: silhouette={scores[k]:.3f}")

best_k = max(scores, key=scores.get)
print(f"\nBest k: {best_k}")
k=2: silhouette=0.354
k=3: silhouette=0.210
k=4: silhouette=0.223
k=5: silhouette=0.257
k=6: silhouette=0.246
k=7: silhouette=0.269
k=8: silhouette=0.257

Best k: 2

PCA visualization

cluster_labels = [
    int(r[0]) for r in ds.conn.execute(
        "SELECT CAST(value AS INTEGER) FROM predictions WHERE prediction_type='cluster_k3' ORDER BY sequence_id"
    ).fetchall()
]

pca = PCA(n_components=2)
coords = pca.fit_transform(mat)

fig, ax = plt.subplots(figsize=(8, 6))
scatter = ax.scatter(coords[:, 0], coords[:, 1], c=cluster_labels,
                     cmap="Set1", edgecolors="black", linewidth=0.5, alpha=0.8, s=60)
plt.colorbar(scatter, ax=ax, label="Cluster")
ax.set_xlabel(f"PC1 ({pca.explained_variance_ratio_[0]:.1%} variance)")
ax.set_ylabel(f"PC2 ({pca.explained_variance_ratio_[1]:.1%} variance)")
ax.set_title("ESM2-8m embedding space — K-means clusters (k=3)")
plt.tight_layout()
plt.show()
No description has been provided for this image

Diversity sampling

Select 20 maximally diverse representatives spanning all clusters.

diverse_ds = DuckDBDataStore("diverse_demo.duckdb")

dp = DataPipeline(sequences=MY_50_PEPTIDES, datastore=diverse_ds, verbose=True)
dp.add_filter(ValidAminoAcidFilter(), stage_name="validate")
dp.add_prediction(
    "esm2-8m", action="encode",
    embedding_extractor=EmbeddingSpec(key="embeddings", layer=6),
    stage_name="embed", depends_on=["validate"],
)
dp.add_clustering(
    method="kmeans", n_clusters=3,
    similarity_metric="embedding", embedding_model="esm2-8m",
    stage_name="cluster", depends_on=["embed"],
)
dp.add_filter(DiversitySamplingFilter(n_samples=20, method="random"), stage_name="diverse_20")
dp.run()
dp.summary()
Added stage: FilterStage('validate')
Added stage: PredictionStage('embed', depends_on=['validate'])
Added stage: ClusteringStage('cluster', depends_on=['embed'])
Added stage: FilterStage('diverse_20', depends_on=['cluster'])

############################################################
# Pipeline: DataPipeline
# Run ID: 20260617_141556_d43fb8a4
# Initial sequences: 50
# Streaming: ENABLED
############################################################

Execution plan: 4 level(s)
  Level 1: validate
  Level 2: embed
  Level 3: cluster
  Level 4: diverse_20

============================================================
Stage: validate
Input: 50 sequences
  Applying filter: ValidAminoAcidFilter(alphabet='ACDEFGHIKLMNPQRSTVWY')
  Filtered out: 0/50
  Remaining: 50

StageResult(validate: in=50, out=50, cached=0, computed=0, filtered=0, time=0.0s)
============================================================

============================================================
Stage: embed
Input: 50 sequences
Depends on: validate
  Cached: 0/50
  To compute: 50
  Calling esm2-8m.encode...
Completed: 50 sequences in 2 batches (max 5 concurrent)

StageResult(embed: in=50, out=50, cached=0, computed=50, filtered=0, time=0.6s)
============================================================

============================================================
Stage: cluster
Input: 50 sequences
Depends on: embed
  Clustering 50 sequences using kmeans...
  Loading embeddings from esm2-8m...
  Found 3 clusters
  Silhouette score: 0.151

StageResult(cluster: in=50, out=50, cached=0, computed=50, filtered=0, time=0.1s)
============================================================

============================================================
Stage: diverse_20
Input: 50 sequences
Depends on: cluster
  Applying filter: DiversitySamplingFilter(n=20, method='random')
  Filtered out: 30/50
  Remaining: 20

StageResult(diverse_20: in=50, out=20, cached=0, computed=0, filtered=30, time=0.0s)
============================================================

############################################################
# Pipeline completed in 0.8s
# Final sequences: 20
############################################################
Stage Input Output Filtered Cached Computed Time (s)
0 validate 50 50 0 0 0 0.0
1 embed 50 50 0 0 50 0.6
2 cluster 50 50 0 0 50 0.1
3 diverse_20 50 20 30 0 0 0.0

Cleanup

ds.close(); diverse_ds.close()
import os
for f in ["cluster_demo.duckdb", "diverse_demo.duckdb"]:
    if os.path.exists(f): os.remove(f)

Next Steps

Check out additional tutorials at jupyter.biolm.ai, or head over to our BioLM Documentation to explore additional models and functionality.

See more use-cases and APIs on your BioLM Console Catalog.


BioLM hosts deep learning models and runs inference at scale. You do the science.

Contact us to learn more.

Accelerate yourLead generation

BioLM offers tailored AI solutions to meet your experimental needs. We deliver top-tier results with our model-agnostic approach, powered by our highly scalable and real-time GPU-backed APIs and years of experience in biological data modeling, all at a competitive price.

CTA

We speak the language of bio-AI

© 2022 - 2026 BioLM. All Rights Reserved.