NanoBodyBuilder2 is a nanobody-specific deep learning model from the ImmuneBuilder suite that predicts all-atom 3D structures for single-chain VHH sequences. Given a heavy-chain-only amino acid sequence (H) up to 2048 residues, the API returns a refined PDB structure, using nanobody-trained networks and an OpenMM-based post-processing pipeline. Typical applications include nanobody structure determination for docking, epitope mapping, library characterization, and structure-guided engineering workflows.

Predict

Predict the 3D structure (PDB) for nanobody heavy chain sequences

python
from biolmai import BioLM
response = BioLM(
    entity="nanobodybuilder2",
    action="predict",
    params={},
    items=[
      {
        'H': 'QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS'
      },
      {
        'H': 'QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGINAGTGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS'
      }
    ]
)
print(response)
bash
curl -X POST https://biolm.ai/api/v3/nanobodybuilder2/predict/ \
  -H "Authorization: Token YOUR_API_KEY" \
  -H "Content-Type: application/json" \
  -d '{
  "items": [
    {
      "H": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    },
    {
      "H": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGINAGTGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    }
  ],
  "params": {}
}'
python
import requests

url = "https://biolm.ai/api/v3/nanobodybuilder2/predict/"
headers = {
    "Authorization": "Token YOUR_API_KEY",
    "Content-Type": "application/json"
}
payload = {
      "items": [
        {
          "H": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
        },
        {
          "H": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGINAGTGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
        }
      ],
      "params": {}
    }

response = requests.post(url, headers=headers, json=payload)
print(response.json())
r
library(httr)

url <- "https://biolm.ai/api/v3/nanobodybuilder2/predict/"
headers <- c("Authorization" = "Token YOUR_API_KEY", "Content-Type" = "application/json")
body <- list(
  items = list(
    list(
      H = "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    ),
    list(
      H = "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGINAGTGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    )
  ),
  params = list()
)

res <- POST(url, add_headers(.headers = headers), body = body, encode = "json")
print(content(res))
POST /api/v3/nanobodybuilder2/predict/

Predict endpoint for NanoBodyBuilder2.

Request Headers:

Request

  • params (object, optional) — Configuration parameters:

    • (no parameters are currently defined for this endpoint; pass an empty object or omit this field)

  • items (array of objects, min items: 1, max items: 8) — Input nanobody sequences:

    • H (string, min length: 1, max length: 2048, required) — Nanobody heavy-chain amino acid sequence using unambiguous amino acid codes

Example request:

http
POST /api/v3/nanobodybuilder2/predict/ HTTP/1.1
Host: biolm.ai
Authorization: Token YOUR_API_KEY
Content-Type: application/json

      {
  "items": [
    {
      "H": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    },
    {
      "H": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGINAGTGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    }
  ],
  "params": {}
}
Status Codes:

Response

  • results (array of objects) — One result per input item, in the order requested:

    • pdb (string) — Predicted 3D structure in PDB format, including ATOM/HETATM records and REMARK lines

Example response:

http
HTTP/1.1 200 OK
Content-Type: application/json

      {
  "results": [
    {
      "pdb": "REMARK  NANOBODY STRUCTURE MODELLED USING NANOBODYBUILDER2                      \nREMARK  STRUCTURE REFINED USING OPENMM 8.2, 2025-06-18                          \nATOM      1  N   GLN H   1     -10.553... (truncated for documentation)"
    },
    {
      "pdb": "REMARK  NANOBODY STRUCTURE MODELLED USING NANOBODYBUILDER2                      \nREMARK  STRUCTURE REFINED USING OPENMM 8.2, 2025-06-18                          \nATOM      1  N   GLN H   1     -10.462... (truncated for documentation)"
    }
  ]
}

Performance

  • NanoBodyBuilder2 is specialised for nanobody 3D structure prediction and, on published benchmarks, achieves lower backbone RMSD than general-purpose models and homology-based tools (mean CDR3 RMSD 2.89 Å vs 3.44 Å for AlphaFold2; framework RMSD 0.79 Å vs 1.09 Å for ABodyBuilder and 1.19 Å for MOE).

  • Compared with AlphaFold2-based structure-prediction services on BioLM, NanoBodyBuilder2 is substantially faster and cheaper for nanobody targets because it is alignment-free, does not query large external databases, and runs with a small CPU-only footprint (no GPU required).

  • Within the ImmuneBuilder family (ABodyBuilder2, TCRBuilder2/TCRBuilder2+), NanoBodyBuilder2 offers nanobody accuracy on par with the antibody and TCR variants while sharing their low resource requirements (2 vCPUs, 8 GB RAM per worker), making it suitable for high-throughput nanobody structure prediction compared to GPU-dependent models such as AlphaFold2.

Applications

  • Structure-guided nanobody humanization by modelling how candidate framework and CDR substitutions perturb the 3D Ig fold and paratope geometry; enables therapeutic teams to down‑select humanizing mutations that are structurally compatible before expression; relies on static structural proxies and still requires experimental immunogenicity and developability assessment.

  • Affinity maturation support for nanobodies by rapidly predicting 3D structures of mutational variants so in silico libraries can be ranked and filtered for plausible binding-site architectures; helps focus wet‑lab screening on variants that preserve CDR1/CDR2 topologies and side chain packing; less informative for designs that aim to radically reshape highly variable CDR3 loops without binding data.

  • Stability-oriented engineering of nanobody candidates using predicted structures to flag mutations that improve core packing, reduce loop strain, or eliminate buried polar and charged residues; allows formulation and developability teams to triage variants for thermostability and aggregation assays; predictions indicate structural plausibility only and do not substitute for empirical stability measurements.

  • Sequence liability mitigation by using nanobody models to locate surface-exposed hydrophobic patches, deamidation-prone Asn, or oxidation-sensitive Met in structurally important regions and redesigning them while maintaining the Ig domain; supports early reduction of downstream manufacturing and formulation risks; less effective for liabilities dominated by formulation conditions or dynamic/post-translational effects not captured in a single predicted structure.

  • Structure-aware nanobody library design for discovery and optimization campaigns by generating models for large sequence sets and discarding variants that disrupt the canonical nanobody framework or collapse CDRs; enables focused libraries enriched for structurally viable binders, improving hit quality and reducing non-expressing or misfolded clones; predictions are most reliable for framework and CDR1/CDR2 variation, with CDR3 diversity still best refined via iterative experimental feedback.

Limitations

  • Maximum Sequence Length: Each nanobody heavy chain H in ImmuneBuilderNanoBodyBuilder2PredictRequest.items must be between 1 and 2048 amino acids. Sequences outside this range, or containing ambiguous (non-standard) amino acids, are rejected by the aa_unambiguous_validator.

  • Batch Size: The items array in ImmuneBuilderNanoBodyBuilder2PredictRequest accepts up to 8 nanobody sequences per call (batch_size = 8). Larger datasets must be split across multiple API requests.

  • Input Format: NanoBodyBuilder2 expects a single VHH-like chain provided via the required H field only. Requests including any additional keys (for example L, A, B or other extra fields) are not allowed (extra = "forbid") and will raise a validation error.

  • Scope of Model: The model is specialised for nanobody (single-domain VHH) structures. It is not suitable for full-length antibodies, multispecific formats, TCRs, or arbitrary proteins, where antibody- or general-purpose structure models (for example abodybuilder2, AlphaFold2, ESMFold) are more appropriate.

  • CDR3 and Loop Accuracy: As with other immune-structure models, backbone predictions for framework regions and CDR1/CDR2 are typically more reliable than for the CDR3 loop, which shows larger structural variability (CDR3 RMSDs around 2.9 Å on benchmark data). Use CDR3 conformations cautiously in applications that require precise loop geometry, such as detailed docking or affinity estimation.

  • Training Distribution: NanoBodyBuilder2 was trained primarily on natural camelid/llama nanobody structures. Performance may degrade for highly engineered, humanised, unusually long/short, or heavily mutated nanobodies that deviate strongly from these sequence and length distributions.

How We Use It

NanoBodyBuilder2 is used in BioLM workflows to rapidly generate 3D structures from nanobody heavy-chain sequences so teams can run structure-guided design without solving experimental structures for every variant. Predicted models are consumed by downstream thermostability and developability scoring, docking, and sequence-embedding–based screening pipelines to prioritize candidates for synthesis, with particular attention to CDR3 geometry and surface-exposed liabilities.

  • Enables iterative nanobody optimization and humanization by providing fast structural feedback on sequence changes.

  • Integrates via standardized, scalable APIs with binding, stability, and liability prediction tools to shorten design–build–test cycles.

References