Sadie Antibody (SADIE) provides AIRR-compliant BCR/TCR annotation and antibody numbering, assigning V/J genes, chain type, CDR and framework regions, and per-region identities and scores directly from amino acid sequences. The API supports configurable numbering schemes (Chothia, IMGT, Kabat) and region definitions (including ABM, contact, SCDR), with batch processing of up to 8 sequences of length ≤2048. Results are returned as structured tables suitable for repertoire analysis, clonotyping, lineage tracing, and therapeutic antibody design workflows.

Predict

Predict properties or scores for input sequences

python
from biolmai import BioLM
response = BioLM(
    entity="sadie-antibody",
    action="predict",
    params={
      'region_assign': 'imgt',
      'scheme': 'chothia',
      'scfv': False,
      'allowed_chain': [
        'H',
        'K',
        'L'
      ]
    },
    items=[
      {
        'sequence': 'QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS'
      }
    ]
)
print(response)
bash
curl -X POST https://biolm.ai/api/v3/sadie-antibody/predict/ \
  -H "Authorization: Token YOUR_API_KEY" \
  -H "Content-Type: application/json" \
  -d '{
  "params": {
    "region_assign": "imgt",
    "scheme": "chothia",
    "scfv": false,
    "allowed_chain": [
      "H",
      "K",
      "L"
    ]
  },
  "items": [
    {
      "sequence": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    }
  ]
}'
python
import requests

url = "https://biolm.ai/api/v3/sadie-antibody/predict/"
headers = {
    "Authorization": "Token YOUR_API_KEY",
    "Content-Type": "application/json"
}
payload = {
      "params": {
        "region_assign": "imgt",
        "scheme": "chothia",
        "scfv": false,
        "allowed_chain": [
          "H",
          "K",
          "L"
        ]
      },
      "items": [
        {
          "sequence": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
        }
      ]
    }

response = requests.post(url, headers=headers, json=payload)
print(response.json())
r
library(httr)

url <- "https://biolm.ai/api/v3/sadie-antibody/predict/"
headers <- c("Authorization" = "Token YOUR_API_KEY", "Content-Type" = "application/json")
body <- list(
  params = list(
    region_assign = "imgt",
    scheme = "chothia",
    scfv = FALSE,
    allowed_chain = list(
      "H",
      "K",
      "L"
    )
  ),
  items = list(
    list(
      sequence = "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    )
  )
)

res <- POST(url, add_headers(.headers = headers), body = body, encode = "json")
print(content(res))
POST /api/v3/sadie-antibody/predict/

Predict endpoint for Sadie Antibody.

Request Headers:

Request

  • params (object, required) — Configuration parameters:

    • region_assign (enum: [imgt, kabat, chothia, abm, contact, scdr], default: “imgt”, optional) — Region definition used for framework and CDR segmentation

    • scheme (enum: [imgt, kabat, chothia], default: “chothia”, optional) — Numbering scheme applied to sequences

    • scfv (boolean, default: false) — Whether to allow single-chain Fv sequences

    • allowed_chain (array of strings, default: [“H”, “K”, “L”]) — Chain types to include; each element must be one of [“L”, “H”, “K”, “A”, “B”, “G”, “D”]

  • items (array of objects, min: 1, max: 8, required) — Input sequences:

    • sequence (string, min length: 1, max length: 2048, required) — Amino acid sequence using extended amino acid codes

Example request:

http
POST /api/v3/sadie-antibody/predict/ HTTP/1.1
Host: biolm.ai
Authorization: Token YOUR_API_KEY
Content-Type: application/json

      {
  "params": {
    "region_assign": "imgt",
    "scheme": "chothia",
    "scfv": false,
    "allowed_chain": [
      "H",
      "K",
      "L"
    ]
  },
  "items": [
    {
      "sequence": "QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMGGISPYRGDTIYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYCARDGYSSGYYGMDVWGQGTTVTVSS"
    }
  ]
}
Status Codes:

Response

  • results (array of objects) — One result per input item, in the order requested:

    • domain_no (int) — Zero-based index of the matched antibody domain

    • hmm_species (string) — Species label from HMM alignment (e.g. “human”)

    • chain_type (string) — Single-letter chain type inferred by HMM (e.g. “H”, “K”, “L”)

    • e_value (float) — HMM alignment E-value

    • score (float) — HMM alignment score

    • identity_species (string) — Species with highest sequence identity

    • v_gene (string) — Top V gene call, including allele (e.g. “IGHV1-24*01”)

    • v_identity (float) — V gene identity as a fraction (0.0–1.0)

    • j_gene (string) — Top J gene call, including allele (e.g. “IGHJ6*01”)

    • j_identity (float) — J gene identity as a fraction (0.0–1.0)

    • Chain (string) — Single-letter chain label matching the numbered chain

    • Numbering (array of ints, length ≤ 2048) — Residue numbering assigned to each input position

    • Insertion (array of strings, length ≤ 2048) — Insertion codes for each numbered position

    • scheme (string) — Applied numbering scheme (e.g. “chothia”, “kabat”, “imgt”)

    • region_definition (string) — Applied CDR/framework region definition (e.g. “imgt”, “kabat”)

    • fwr1_aa_gaps (string) — FWR1 amino acid sequence including internal gaps

    • fwr1_aa_no_gaps (string) — FWR1 amino acid sequence with gaps removed

    • cdr1_aa_gaps (string) — CDR1 amino acid sequence including internal gaps

    • cdr1_aa_no_gaps (string) — CDR1 amino acid sequence with gaps removed

    • fwr2_aa_gaps (string) — FWR2 amino acid sequence including internal gaps

    • fwr2_aa_no_gaps (string) — FWR2 amino acid sequence with gaps removed

    • cdr2_aa_gaps (string) — CDR2 amino acid sequence including internal gaps

    • cdr2_aa_no_gaps (string) — CDR2 amino acid sequence with gaps removed

    • fwr3_aa_gaps (string) — FWR3 amino acid sequence including internal gaps

    • fwr3_aa_no_gaps (string) — FWR3 amino acid sequence with gaps removed

    • cdr3_aa_gaps (string) — CDR3 amino acid sequence including internal gaps

    • cdr3_aa_no_gaps (string) — CDR3 amino acid sequence with gaps removed

    • fwr4_aa_gaps (string) — FWR4 amino acid sequence including internal gaps

    • fwr4_aa_no_gaps (string) — FWR4 amino acid sequence with gaps removed

    • leader (string) — Amino acids before the aligned domain

    • follow (string) — Amino acids after the aligned domain

Example response:

http
HTTP/1.1 200 OK
Content-Type: application/json

      {
  "results": [
    {
      "domain_no": 0,
      "hmm_species": "human",
      "chain_type": "H",
      "e_value": 0.0,
      "score": 176.25,
      "identity_species": "human",
      "v_gene": "IGHV1-24*01",
      "v_identity": 0.87,
      "j_gene": "IGHJ6*01",
      "j_identity": 1.0,
      "Chain": "H",
      "Numbering": [
        1,
        2,
        3,
        "... (truncated for documentation)"
      ],
      "Insertion": [
        "",
        "",
        "",
        "... (truncated for documentation)"
      ],
      "scheme": "chothia",
      "region_definition": "imgt",
      "fwr1_aa_gaps": "QVQLVQSGAEVKKPGASVKVSCKVS",
      "fwr1_aa_no_gaps": "QVQLVQSGAEVKKPGASVKVSCKVS",
      "cdr1_aa_gaps": "GYTSP-TT",
      "cdr1_aa_no_gaps": "GYTSPTT",
      "fwr2_aa_gaps": "IHWVRQAPGKGLEWMGG",
      "fwr2_aa_no_gaps": "IHWVRQAPGKGLEWMGG",
      "cdr2_aa_gaps": "ISPYRGDT",
      "cdr2_aa_no_gaps": "ISPYRGDT",
      "fwr3_aa_gaps": "IYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYC",
      "fwr3_aa_no_gaps": "IYAQKFQGRVTMTEDTSTDTAYMELSSLKSEDTAVYYC",
      "cdr3_aa_gaps": "ARDGYSSGYYGMDV",
      "cdr3_aa_no_gaps": "ARDGYSSGYYGMDV",
      "fwr4_aa_gaps": "WGQGTTVTVSS",
      "fwr4_aa_no_gaps": "WGQGTTVTVSS",
      "leader": "",
      "follow": ""
    }
  ]
}

Performance

  • CPU-optimized HMM-based implementation for antibody numbering and region annotation, deployed on lightweight containers (0.125 vCPU, 1 GB RAM per worker), allowing many concurrent requests without GPU dependency.

  • Throughput and latency are substantially better than BLAST-based tools (e.g., IgBLAST) for V/J assignment and region delineation, and typically faster than ANARCI-style HMM pipelines at comparable accuracy due to streamlined SADIE integration and minimal I/O overhead.

  • Within the BioLM portfolio, Sadie Antibody is among the most efficient sequence-analysis APIs per CPU minute: markedly cheaper and lower-latency than large protein language model–based annotation workflows, while providing similar or better alignment- and region-level accuracy for standard antibody engineering tasks.

Applications

  • Antibody sequence annotation to identify CDRs and framework regions, enabling systematic engineering workflows such as affinity maturation, de-immunization, and epitope mapping by precisely localizing sequence changes to functional regions

  • Clustering antibodies by CDR amino acid similarity using SADIE-compatible outputs to group related clones or lineages in large discovery campaigns, supporting repertoire down-selection and hit expansion; clustering works best within reasonably related sequence sets and may be less informative for highly divergent repertoires

  • AIRR-compliant annotation outputs that interoperate with downstream immunoinformatics tools (e.g., immcantation pipelines, AIRR-compliant databases), simplifying integration of SADIE-based workflows into existing discovery, developability, and clinical sequence analysis pipelines

  • Antibody variable region numbering with common schemes (Chothia, Kabat, IMGT) and region definitions (e.g., IMGT, Kabat, Chothia, ABM, contact, SCDR) to standardize residue indexing across internal and external datasets, facilitating structural modeling, mutational scanning analysis, IP comparisons, and regulatory documentation; numbering is intended for conventional immunoglobulin chains and may not generalize to non-standard antibody-like formats

  • Generation of residue-level annotated sequence data (including V/J gene calls, species assignment, per-region sequences, and numbering arrays) that can be used as structured features for downstream computational workflows such as repertoire profiling, developability rule filters, or ML models for antibody design and liability prediction, but is not a substitute for 3D structural modeling or docking analyses

Limitations

  • Maximum Sequence Length: Each sequence must be at most 2048 amino acids (SADIEParams.max_sequence_len). Longer sequences must be truncated or split before calling predictor.

  • Batch Size: Each predictor request must contain between 1 and 8 items (SADIEParams.batch_size). Larger datasets should be processed in multiple requests.

  • Numbering Schemes and Regions: scheme is limited to imgt, kabat, or chothia (SADIENumbering). region_assign is limited to imgt, kabat, chothia, abm, contact, or scdr (SADIERegion); custom schemes or region definitions are not supported.

  • Chain Type Constraints: allowed_chain must be a subset of ["L", "H", "K", "A", "B", "G", "D"] and defaults to heavy/light chains (["H", "K", "L"]). Other chain types or non-standard receptor formats may fail HMM assignment or produce low-quality annotations.

  • Species and Germline Coverage: hmm_species, v_gene, and j_gene in the results are derived from SADIE’s built-in germline database, which is curated mainly for human and common model organisms. Rare species, heavily engineered antibodies, or highly divergent germlines may be mis-assigned or left unannotated.

  • Non-optimal Use Cases: SADIE is optimized for antibody/BCR/TCR variable-region annotation and numbering. It is not ideal for full-length Ig constructs with long constant regions, non-immunoglobulin proteins, or tasks such as affinity prediction, developability scoring, or structure modeling; other BioLM models are more appropriate for those use cases.

How We Use It

Sadie Antibody enables standardized numbering, region parsing, and light/heavy chain typing for antibody amino acid sequences, giving downstream design models consistent CDR and framework definitions across large datasets. We integrate Sadie outputs directly into generative design, developability prediction, and clustering workflows, so candidate ranking, epitope-focused mutagenesis, and sequence liability analysis all operate on the same AIRR-compliant region boundaries and V/J gene calls.

  • Supports IMGT, Kabat, and Chothia schemes and multiple region definitions (e.g., ABM, contact, SCDR) via a single scalable API, simplifying alignment of internal and partner pipelines.

  • Accelerates lead selection by turning raw sequences into structured features (CDRs, FWRs, gene usage, species identity) that can be filtered, embedded, and iteratively optimized across design-make-test cycles.

References